SCOPe 2.02: Domain d2ce8c_: 2ce8 C:

Lineage for d2ce8c_ (2ce8 C:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.4: WD40 repeat-like [50978] (3 families)
   also contains 8-bladed propellers

5. Family b.69.4.1: WD40-repeat [50979] (11 proteins)
   this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain

6. Protein Groucho/tle1, C-terminal domain [75009] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75010] (3 PDB entries)

8. Domain d2ce8c_: 2ce8 C: [130326]
   automated match to d1gxra_

Details for d2ce8c_

PDB Entry: 2ce8, 2.03 Å

PDB Description: an eh1 peptide bound to the groucho-tle wd40 domain.

PDB Compounds: (C:) transducin-like enhancer protein 1

SCOPe Domain Sequences for d2ce8c_:

Sequence; same for both SEQRES and ATOM records:

>d2ce8c_ b.69.4.1 (C:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dyfqgamgskpaysfhvtadgqmqpvpfppdaligpgiprharqintlnhgevvcavtis
nptrhvytggkgcvkvwdishpgnkspvsqldclnrdnyirsckllpdgctlivggeast
lsiwdlaaptprikaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfq
ghtdgascidisndgtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewla
vgmessnvevlhvnkpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasi
fqskesssvlscdisvddkyivtgsgdkkatvyeviy

Timeline for d2ce8c_:

• d2ce8c_ first appeared in SCOP 1.73, called d2ce8c1
  
• d2ce8c_ appears in SCOPe 2.01
  
• d2ce8c_ appears in SCOPe 2.03
  
• d2ce8c_ appears in the current release, SCOPe 2.08, called d2ce8c2