SCOP 1.75: Domain d2ce8b1: 2ce8 B:434-770

Lineage for d2ce8b1 (2ce8 B:434-770)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.4: WD40 repeat-like [50978] (2 families)
   also contains 8-bladed propellers

5. Family b.69.4.1: WD40-repeat [50979] (10 proteins)
   this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain

6. Protein Groucho/tle1, C-terminal domain [75009] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75010] (3 PDB entries)

8. Domain d2ce8b1: 2ce8 B:434-770 [130325]
   automatically matched to d1gxra_

Details for d2ce8b1

PDB Entry: 2ce8, 2.03 Å

PDB Description: an eh1 peptide bound to the groucho-tle wd40 domain.

PDB Compounds: (B:) transducin-like enhancer protein 1

SCOP Domain Sequences for d2ce8b1:

Sequence; same for both SEQRES and ATOM records:

>d2ce8b1 b.69.4.1 (B:434-770) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dyfqgamgskpaysfhvtadgqmqpvpfppdaligpgiprharqintlnhgevvcavtis
nptrhvytggkgcvkvwdishpgnkspvsqldclnrdnyirsckllpdgctlivggeast
lsiwdlaaptprikaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfq
ghtdgascidisndgtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewla
vgmessnvevlhvnkpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasi
fqskesssvlscdisvddkyivtgsgdkkatvyeviy

Timeline for d2ce8b1:

• d2ce8b1 first appeared in SCOP 1.73
  
• d2ce8b1 is called d2ce8b_ in SCOPe 2.01
  
• d2ce8b1 appears in the current release, SCOPe 2.08, called d2ce8b2