Lineage for d2ce8b1 (2ce8 B:434-770)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 675262Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 675344Superfamily b.69.4: WD40 repeat-like [50978] (2 families) (S)
    also contains 8-bladed propellers
  5. 675345Family b.69.4.1: WD40-repeat [50979] (8 proteins)
    this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain
  6. 675398Protein Groucho/tle1, C-terminal domain [75009] (1 species)
  7. 675399Species Human (Homo sapiens) [TaxId:9606] [75010] (3 PDB entries)
  8. 675403Domain d2ce8b1: 2ce8 B:434-770 [130325]
    automatically matched to d1gxra_

Details for d2ce8b1

PDB Entry: 2ce8 (more details), 2.03 Å

PDB Description: an eh1 peptide bound to the groucho-tle wd40 domain.
PDB Compounds: (B:) transducin-like enhancer protein 1

SCOP Domain Sequences for d2ce8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ce8b1 b.69.4.1 (B:434-770) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dyfqgamgskpaysfhvtadgqmqpvpfppdaligpgiprharqintlnhgevvcavtis
nptrhvytggkgcvkvwdishpgnkspvsqldclnrdnyirsckllpdgctlivggeast
lsiwdlaaptprikaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfq
ghtdgascidisndgtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewla
vgmessnvevlhvnkpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasi
fqskesssvlscdisvddkyivtgsgdkkatvyeviy

SCOP Domain Coordinates for d2ce8b1:

Click to download the PDB-style file with coordinates for d2ce8b1.
(The format of our PDB-style files is described here.)

Timeline for d2ce8b1: