Lineage for d2ce8a_ (2ce8 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 960204Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 960290Superfamily b.69.4: WD40 repeat-like [50978] (3 families) (S)
    also contains 8-bladed propellers
  5. 960291Family b.69.4.1: WD40-repeat [50979] (11 proteins)
    this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain
  6. 960348Protein Groucho/tle1, C-terminal domain [75009] (1 species)
  7. 960349Species Human (Homo sapiens) [TaxId:9606] [75010] (3 PDB entries)
  8. 960352Domain d2ce8a_: 2ce8 A: [130324]
    automated match to d1gxra_

Details for d2ce8a_

PDB Entry: 2ce8 (more details), 2.03 Å

PDB Description: an eh1 peptide bound to the groucho-tle wd40 domain.
PDB Compounds: (A:) transducin-like enhancer protein 1

SCOPe Domain Sequences for d2ce8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ce8a_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dyfqgamgskpaysfhvtadgqmqpvpfppdaligpgiprharqintlnhgevvcavtis
nptrhvytggkgcvkvwdishpgnkspvsqldclnrdnyirsckllpdgctlivggeast
lsiwdlaaptprikaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfq
ghtdgascidisndgtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewla
vgmessnvevlhvnkpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasi
fqskesssvlscdisvddkyivtgsgdkkatvyeviy

SCOPe Domain Coordinates for d2ce8a_:

Click to download the PDB-style file with coordinates for d2ce8a_.
(The format of our PDB-style files is described here.)

Timeline for d2ce8a_: