![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.69.4: WD40 repeat-like [50978] (2 families) ![]() also contains 8-bladed propellers |
![]() | Family b.69.4.1: WD40-repeat [50979] (10 proteins) this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain |
![]() | Protein Groucho/tle1, C-terminal domain [75009] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [75010] (3 PDB entries) |
![]() | Domain d2ce8a1: 2ce8 A:434-770 [130324] automatically matched to d1gxra_ |
PDB Entry: 2ce8 (more details), 2.03 Å
SCOP Domain Sequences for d2ce8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ce8a1 b.69.4.1 (A:434-770) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} dyfqgamgskpaysfhvtadgqmqpvpfppdaligpgiprharqintlnhgevvcavtis nptrhvytggkgcvkvwdishpgnkspvsqldclnrdnyirsckllpdgctlivggeast lsiwdlaaptprikaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfq ghtdgascidisndgtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewla vgmessnvevlhvnkpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasi fqskesssvlscdisvddkyivtgsgdkkatvyeviy
Timeline for d2ce8a1: