Lineage for d2ce3d_ (2ce3 D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2112071Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2112072Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2113065Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2113066Protein automated matches [190246] (54 species)
    not a true protein
  7. 2113448Species Mycobacterium tuberculosis [TaxId:83332] [187022] (11 PDB entries)
  8. 2113477Domain d2ce3d_: 2ce3 D: [130300]
    automated match to d1tyfa_

Details for d2ce3d_

PDB Entry: 2ce3 (more details), 2.6 Å

PDB Description: crystal structure of the atp-dependent clp protease proteolytic subunit 1 (clpp1) from mycobacterium tuberculosis
PDB Compounds: (D:) ATP-dependent clp protease proteolytic subunit 1

SCOPe Domain Sequences for d2ce3d_:

Sequence, based on SEQRES records: (download)

>d2ce3d_ c.14.1.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqplggvtgsaa
diaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiit

Sequence, based on observed residues (ATOM records): (download)

>d2ce3d_ c.14.1.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqpiaiqaeqfa
vikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiit

SCOPe Domain Coordinates for d2ce3d_:

Click to download the PDB-style file with coordinates for d2ce3d_.
(The format of our PDB-style files is described here.)

Timeline for d2ce3d_: