Class b: All beta proteins [48724] (177 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein automated matches [190043] (6 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [187080] (7 PDB entries) |
Domain d2cdta_: 2cdt A: [130296] automated match to d1pwt__ mutant |
PDB Entry: 2cdt (more details), 2.54 Å
SCOPe Domain Sequences for d2cdta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cdta_ b.34.2.1 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} kelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndrqgfvpasyvkkld
Timeline for d2cdta_: