Lineage for d2cdhd2 (2cdh D:254-406)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2164457Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2164458Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2164459Family c.95.1.1: Thiolase-related [53902] (10 proteins)
  6. 2164480Protein Beta-ketoacyl-ACP synthase I [53907] (1 species)
  7. 2164481Species Escherichia coli [TaxId:562] [53908] (19 PDB entries)
    Uniprot P14926
  8. 2164629Domain d2cdhd2: 2cdh D:254-406 [130277]
    Other proteins in same PDB: d2cdhg1, d2cdhh1, d2cdhi1, d2cdhj1, d2cdhk1, d2cdhl1, d2cdhs1
    automatically matched to d1dd8a2

Details for d2cdhd2

PDB Entry: 2cdh (more details), 5 Å

PDB Description: architecture of the thermomyces lanuginosus fungal fatty acid synthase at 5 angstrom resolution.
PDB Compounds: (D:) ketoacyl synthase

SCOPe Domain Sequences for d2cdhd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cdhd2 c.95.1.1 (D:254-406) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]}
yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgtstpvgdvkelaai
revfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni
vtettdrelttvmsnsfgfggtnatlvmrklkd

SCOPe Domain Coordinates for d2cdhd2:

Click to download the PDB-style file with coordinates for d2cdhd2.
(The format of our PDB-style files is described here.)

Timeline for d2cdhd2: