![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein T-cell antigen receptor [49125] (6 species) |
![]() | Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (16 PDB entries) |
![]() | Domain d2cdef2: 2cde F:117-245 [130269] Other proteins in same PDB: d2cdeb1, d2cded1, d2cdef1 automatically matched to d1bd2e2 |
PDB Entry: 2cde (more details), 3.5 Å
SCOP Domain Sequences for d2cdef2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cdef2 b.1.1.2 (F:117-245) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpq plkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqiv saeawgrad
Timeline for d2cdef2:
![]() Domains from other chains: (mouse over for more information) d2cdeb1, d2cdeb2, d2cded1, d2cded2 |