Lineage for d2cdef1 (2cde F:5-116)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757747Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 1757775Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (29 PDB entries)
  8. 1757813Domain d2cdef1: 2cde F:5-116 [130268]
    Other proteins in same PDB: d2cdea2, d2cdeb2, d2cdec1, d2cdec2, d2cded2, d2cdee1, d2cdee2, d2cdef2
    automatically matched to d1bd2e1

Details for d2cdef1

PDB Entry: 2cde (more details), 3.5 Å

PDB Description: structure and binding kinetics of three different human cd1d-alpha-galactosylceramide specific t cell receptors -inkt-tcr
PDB Compounds: (F:) inkt-tcr

SCOPe Domain Sequences for d2cdef1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cdef1 b.1.1.1 (F:5-116) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
iyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstekgdlsse
stvsrirtehfpltlesarpshtsqylcassenigtayeqyfgpgtrltvte

SCOPe Domain Coordinates for d2cdef1:

Click to download the PDB-style file with coordinates for d2cdef1.
(The format of our PDB-style files is described here.)

Timeline for d2cdef1: