SCOPe 2.02: Domain d2cdeb1: 2cde B:5-116

Lineage for d2cdeb1 (2cde B:5-116)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (30 PDB entries)

8. Domain d2cdeb1: 2cde B:5-116 [130264]
   Other proteins in same PDB: d2cdea2, d2cdeb2, d2cdec1, d2cdec2, d2cded2, d2cdee1, d2cdee2, d2cdef2
   automatically matched to d1bd2e1

Details for d2cdeb1

PDB Entry: 2cde, 3.5 Å

PDB Description: structure and binding kinetics of three different human cd1d-alpha-galactosylceramide specific t cell receptors -inkt-tcr

PDB Compounds: (B:) inkt-tcr

SCOPe Domain Sequences for d2cdeb1:

Sequence; same for both SEQRES and ATOM records:

>d2cdeb1 b.1.1.1 (B:5-116) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
iyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstekgdlsse
stvsrirtehfpltlesarpshtsqylcassenigtayeqyfgpgtrltvte

Timeline for d2cdeb1:

• d2cdeb1 first appeared in SCOP 1.73
  
• d2cdeb1 appears in SCOPe 2.01
  
• d2cdeb1 appears in SCOPe 2.03
  
• d2cdeb1 appears in the current release, SCOPe 2.08