Lineage for d2cchd2 (2cch D:309-431)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 644042Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 644043Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 644044Family a.74.1.1: Cyclin [47955] (4 proteins)
  6. 644055Protein Cyclin A [47956] (2 species)
  7. 644056Species Cow (Bos taurus) [TaxId:9913] [47958] (19 PDB entries)
  8. 644060Domain d2cchd2: 2cch D:309-431 [130241]
    Other proteins in same PDB: d2ccha1, d2cchc1
    automatically matched to d1vin_2
    complexed with atp, gol, so4

Details for d2cchd2

PDB Entry: 2cch (more details), 1.7 Å

PDB Description: the crystal structure of cdk2 cyclin a in complex with a substrate peptide derived from cdc modified with a gamma-linked atp analogue
PDB Compounds: (D:) cyclin a2

SCOP Domain Sequences for d2cchd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cchd2 a.74.1.1 (D:309-431) Cyclin A {Cow (Bos taurus) [TaxId: 9913]}
ptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvt
gqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppe
tln

SCOP Domain Coordinates for d2cchd2:

Click to download the PDB-style file with coordinates for d2cchd2.
(The format of our PDB-style files is described here.)

Timeline for d2cchd2: