SCOPe 2.05: Domain d2cchb1: 2cch B:181-308

Lineage for d2cchb1 (2cch B:181-308)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (75 PDB entries)
   Uniprot P20248 175-432

8. Domain d2cchb1: 2cch B:181-308 [130237]
   Other proteins in same PDB: d2ccha_, d2cchc_
   automatically matched to d1vin_1
   complexed with atp, gol, so4

Details for d2cchb1

PDB Entry: 2cch, 1.7 Å

PDB Description: the crystal structure of cdk2 cyclin a in complex with a substrate peptide derived from cdc modified with a gamma-linked atp analogue

PDB Compounds: (B:) cyclin a2

SCOPe Domain Sequences for d2cchb1:

Sequence; same for both SEQRES and ATOM records:

>d2cchb1 a.74.1.1 (B:181-308) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
dihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavnyid
rflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehlvlk
vltfdlaa

Timeline for d2cchb1:

• d2cchb1 first appeared in SCOP 1.73
  
• d2cchb1 appears in SCOPe 2.04
  
• d2cchb1 appears in SCOPe 2.06
  
• d2cchb1 appears in the current release, SCOPe 2.08