Lineage for d2ccda1 (2ccd A:26-432)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2005118Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2005119Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2005953Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 2005954Protein automated matches [191104] (11 species)
    not a true protein
  7. 2006003Species Mycobacterium tuberculosis [TaxId:1773] [254876] (2 PDB entries)
  8. 2006004Domain d2ccda1: 2ccd A:26-432 [130228]
    automated match to d4c50a1
    complexed with hem; mutant

Details for d2ccda1

PDB Entry: 2ccd (more details), 2.1 Å

PDB Description: crystal structure of the catalase-peroxidase (katg) and s315t mutant from mycobacterium tuberculosis
PDB Compounds: (A:) peroxidase/catalase t

SCOPe Domain Sequences for d2ccda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ccda1 a.93.1.0 (A:26-432) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mkypvegggnqdwwpnrlnlkvlhqnpavadpmgaafdyaaevatidvdaltrdieevmt
tsqpwwpadyghygplfirmawhaagtyrihdgrggagggmqrfaplnswpdnasldkar
rllwpvkkkygkklswadlivfagncalesmgfktfgfgfgrvdqwepdevywgkeatwl
gderysgkrdlenplaavqmgliyvnpegpngnpdpmaaavdiretfrrmamndvetaal
ivgghtfgkthgagpadlvgpepeaapleqmglgwkssygtgtgkdaittgievvwtntp
tkwdnsfleilygyeweltkspagawqytakdgagagtipdpfggpgrsptmlatdlslr
vdpiyeritrrwlehpeeladefakawyklihrdmgpvarylgplvp

SCOPe Domain Coordinates for d2ccda1:

Click to download the PDB-style file with coordinates for d2ccda1.
(The format of our PDB-style files is described here.)

Timeline for d2ccda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ccda2