SCOPe 2.06: Domain d2ccaa1: 2cca A:26-432

Lineage for d2ccaa1 (2cca A:26-432)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.0: automated matches [191605] (1 protein)
   not a true family

6. Protein automated matches [191104] (11 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [254876] (2 PDB entries)

8. Domain d2ccaa1: 2cca A:26-432 [130222]
   automated match to d4c50a1
   complexed with hem; mutant

Details for d2ccaa1

PDB Entry: 2cca, 2 Å

PDB Description: Crystal structure of the catalase-peroxidase (KatG) and S315T mutant from Mycobacterium tuberculosis

PDB Compounds: (A:) peroxidase/catalase t

SCOPe Domain Sequences for d2ccaa1:

Sequence; same for both SEQRES and ATOM records:

>d2ccaa1 a.93.1.0 (A:26-432) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mkypvegggnqdwwpnrlnlkvlhqnpavadpmgaafdyaaevatidvdaltrdieevmt
tsqpwwpadyghygplfirmawhaagtyrihdgrggagggmqrfaplnswpdnasldkar
rllwpvkkkygkklswadlivfagncalesmgfktfgfgfgrvdqwepdevywgkeatwl
gderysgkrdlenplaavqmgliyvnpegpngnpdpmaaavdiretfrrmamndvetaal
ivgghtfgkthgagpadlvgpepeaapleqmglgwkssygtgtgkdaitsgievvwtntp
tkwdnsfleilygyeweltkspagawqytakdgagagtipdpfggpgrsptmlatdlslr
vdpiyeritrrwlehpeeladefakawyklihrdmgpvarylgplvp

Timeline for d2ccaa1:

• d2ccaa1 first appeared in SCOP 1.73
  
• d2ccaa1 appears in SCOPe 2.05
  
• d2ccaa1 appears in SCOPe 2.07
  
• d2ccaa1 appears in the current release, SCOPe 2.08