SCOPe 2.04: Domain d2cc1a1: 2cc1 A:27-293

Lineage for d2cc1a1 (2cc1 A:27-293)

1. Root: SCOPe 2.04

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein beta-Lactamase, class A [56606] (16 species)

7. Species Mycobacterium fortuitum [TaxId:1766] [56615] (1 PDB entry)

8. Domain d2cc1a1: 2cc1 A:27-293 [130211]
   automatically matched to d1mfoa_

Details for d2cc1a1

PDB Entry: 2cc1, 2.13 Å

PDB Description: crystal structure of the class a beta-lactamase from mycobacterium fortuitum

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d2cc1a1:

Sequence; same for both SEQRES and ATOM records:

>d2cc1a1 e.3.1.1 (A:27-293) beta-Lactamase, class A {Mycobacterium fortuitum [TaxId: 1766]}
apiddqlaelerrdnvliglyaanlqsgrrithrpdemfamcstfkgyvaarvlqmaehg
eisldnrvfvdadalvpnspvtearagaemtlaelcqaalqrsdntaanlllktiggpaa
vtafarsvgdertrldrwevelnsaipgdprdtstpaalavgyrailagdalsppqrgll
edwmranqtssmraglpegwttadktgsgdygstndagiafgpdgqrlllvmmtrsqahd
pkaenlrpligeltalvlpsll

Timeline for d2cc1a1:

• d2cc1a1 first appeared in SCOP 1.73
  
• d2cc1a1 appears in SCOPe 2.03
  
• d2cc1a1 appears in SCOPe 2.05
  
• d2cc1a1 appears in the current release, SCOPe 2.08