| Class a: All alpha proteins [46456] (258 folds) |
| Fold a.246: Hyaluronidase domain-like [140656] (2 superfamilies) 5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology |
Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (1 family) ![]() |
| Family a.246.1.1: Hyaluronidase post-catalytic domain-like [140658] (2 proteins) |
| Protein Hyaluronidase, post-catalytic domain 3 [140659] (1 species) |
| Species Clostridium perfringens [TaxId:1502] [140660] (2 PDB entries) |
| Domain d2cbjb1: 2cbj B:496-624 [130188] Other proteins in same PDB: d2cbja2, d2cbja3, d2cbjb2, d2cbjb3 automatically matched to 2CBI A:496-624 complexed with cl, oan |
PDB Entry: 2cbj (more details), 2.35 Å
SCOP Domain Sequences for d2cbjb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cbjb1 a.246.1.1 (B:496-624) Hyaluronidase, post-catalytic domain 3 {Clostridium perfringens [TaxId: 1502]}
edapelrakmdelwnklsskedasalieelygefarmeeacnnlkanlpevaleecsrql
delitlaqgdkasldmivaqlnedteayesakeiaqnklntalssfavisekvaqsfiqe
alsfdltli
Timeline for d2cbjb1: