SCOPe 2.07: Domain d2cbib3: 2cbi B:41-178

Lineage for d2cbib3 (2cbi B:41-178)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families)
   contains similar fold but lacks its catalytic centre

5. Family d.92.2.3: Hyaluronidase N-terminal domain-like [143618] (2 proteins)

6. Protein Hyaluronidase N-terminal domain [143619] (1 species)

7. Species Clostridium perfringens [TaxId:1502] [143620] (7 PDB entries)
   Uniprot Q8XL08 41-178

8. Domain d2cbib3: 2cbi B:41-178 [130184]
   Other proteins in same PDB: d2cbia1, d2cbia2, d2cbib1, d2cbib2
   automated match to d2cbia3
   complexed with cl, gbl, gol, so4, zn

Details for d2cbib3

PDB Entry: 2cbi, 2.25 Å

PDB Description: structure of the clostridium perfringens nagj family 84 glycoside hydrolase, a homologue of human o-glcnacase

PDB Compounds: (B:) hyaluronidase

SCOPe Domain Sequences for d2cbib3:

Sequence; same for both SEQRES and ATOM records:

>d2cbib3 d.92.2.3 (B:41-178) Hyaluronidase N-terminal domain {Clostridium perfringens [TaxId: 1502]}
vlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltannieinsendpn
sttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgdgtfygvqtfk
qlvkesnipevnitdypt

Timeline for d2cbib3:

• d2cbib3 first appeared in SCOP 1.73
  
• d2cbib3 appears in SCOPe 2.06
  
• d2cbib3 appears in the current release, SCOPe 2.08