Lineage for d2cbib3 (2cbi B:41-178)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2571709Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 2571780Family d.92.2.3: Hyaluronidase N-terminal domain-like [143618] (2 proteins)
  6. 2571795Protein Hyaluronidase N-terminal domain [143619] (1 species)
  7. 2571796Species Clostridium perfringens [TaxId:1502] [143620] (7 PDB entries)
    Uniprot Q8XL08 41-178
  8. 2571800Domain d2cbib3: 2cbi B:41-178 [130184]
    Other proteins in same PDB: d2cbia1, d2cbia2, d2cbib1, d2cbib2
    automated match to d2cbia3
    complexed with cl, gbl, gol, so4, zn

Details for d2cbib3

PDB Entry: 2cbi (more details), 2.25 Å

PDB Description: structure of the clostridium perfringens nagj family 84 glycoside hydrolase, a homologue of human o-glcnacase
PDB Compounds: (B:) hyaluronidase

SCOPe Domain Sequences for d2cbib3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cbib3 d.92.2.3 (B:41-178) Hyaluronidase N-terminal domain {Clostridium perfringens [TaxId: 1502]}
vlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltannieinsendpn
sttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgdgtfygvqtfk
qlvkesnipevnitdypt

SCOPe Domain Coordinates for d2cbib3:

Click to download the PDB-style file with coordinates for d2cbib3.
(The format of our PDB-style files is described here.)

Timeline for d2cbib3: