SCOP 1.73: Domain d2cbib1: 2cbi B:496-624

Lineage for d2cbib1 (2cbi B:496-624)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.246: Hyaluronidase domain-like [140656] (2 superfamilies)
   5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology

4. Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (1 family)

5. Family a.246.1.1: Hyaluronidase post-catalytic domain-like [140658] (2 proteins)

6. Protein Hyaluronidase, post-catalytic domain 3 [140659] (1 species)

7. Species Clostridium perfringens [TaxId:1502] [140660] (2 PDB entries)

8. Domain d2cbib1: 2cbi B:496-624 [130182]
   Other proteins in same PDB: d2cbia2, d2cbia3, d2cbib2, d2cbib3
   automatically matched to 2CBI A:496-624
   complexed with cl, gbl, gol, so4, zn

Details for d2cbib1

PDB Entry: 2cbi, 2.25 Å

PDB Description: structure of the clostridium perfringens nagj family 84 glycoside hydrolase, a homologue of human o-glcnacase

PDB Compounds: (B:) hyaluronidase

SCOP Domain Sequences for d2cbib1:

Sequence; same for both SEQRES and ATOM records:

>d2cbib1 a.246.1.1 (B:496-624) Hyaluronidase, post-catalytic domain 3 {Clostridium perfringens [TaxId: 1502]}
edapelrakmdelwnklsskedasalieelygefarmeeacnnlkanlpevaleecsrql
delitlaqgdkasldmivaqlnedteayesakeiaqnklntalssfavisekvaqsfiqe
alsfdltli

Timeline for d2cbib1:

• d2cbib1 is new in SCOP 1.73
  
• d2cbib1 appears in SCOP 1.75
  
• d2cbib1 appears in the current release, SCOPe 2.08