Lineage for d2cbia2 (2cbi A:179-495)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2440813Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (4 proteins)
    Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain
  6. 2440848Protein Hyaluronidase catalytic domain [141792] (1 species)
  7. 2440849Species Clostridium perfringens [TaxId:1502] [141793] (8 PDB entries)
    Uniprot Q8XL08 179-495
  8. 2440852Domain d2cbia2: 2cbi A:179-495 [130180]
    Other proteins in same PDB: d2cbia1, d2cbia3, d2cbib1, d2cbib3
    complexed with cl, gbl, gol, so4, zn

Details for d2cbia2

PDB Entry: 2cbi (more details), 2.25 Å

PDB Description: structure of the clostridium perfringens nagj family 84 glycoside hydrolase, a homologue of human o-glcnacase
PDB Compounds: (A:) hyaluronidase

SCOPe Domain Sequences for d2cbia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cbia2 c.1.8.10 (A:179-495) Hyaluronidase catalytic domain {Clostridium perfringens [TaxId: 1502]}
vsargivegfygtpwthqdrldqikfygenklntyiyapkddpyhrekwrepypesemqr
mqelinasaenkvdfvfgispgidirfdgdageedfnhlitkaeslydmgvrsfaiywdd
iqdksaakhaqvlnrfneefvkakgdvkplitvpteydtgamvsngqpraytrifaetvd
psievmwtgpgvvtneiplsdaqlisgiynrnmavwwnypvtdyfkgklalgpmhgldkg
lnqyvdfftvnpmehaelskisihtaadyswnmdnydydkawnraidmlygdlaedmkvf
anhstrmdnktwaksgr

SCOPe Domain Coordinates for d2cbia2:

Click to download the PDB-style file with coordinates for d2cbia2.
(The format of our PDB-style files is described here.)

Timeline for d2cbia2: