Lineage for d2caya1 (2cay A:1-99,A:252-282)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1323359Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1323360Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1323888Family b.55.1.12: VPS36 N-terminal domain-like [141442] (1 protein)
    PfamB PB030385
  6. 1323889Protein Vacuolar protein sorting protein 36, VPS36 [141443] (3 species)
  7. 1323890Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141445] (1 PDB entry)
    Uniprot Q06696 1-99,252-282
  8. 1323891Domain d2caya1: 2cay A:1-99,A:252-282 [130167]
    complexed with so4

Details for d2caya1

PDB Entry: 2cay (more details), 1.9 Å

PDB Description: vps36 n-terminal ph domain
PDB Compounds: (A:) vacuolar protein sorting protein 36

SCOPe Domain Sequences for d2caya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2caya1 b.55.1.12 (A:1-99,A:252-282) Vacuolar protein sorting protein 36, VPS36 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
meywhyvettssgqpllregekdifidqsvglyhgkskilqrqrgrifltsqriiyidda
kptqnslglelddlayvnyssgfltrsprlilffkdpssXstefvqlsfrksdgvlfsqa
teralenilte

SCOPe Domain Coordinates for d2caya1:

Click to download the PDB-style file with coordinates for d2caya1.
(The format of our PDB-style files is described here.)

Timeline for d2caya1: