SCOPe 2.06: Domain d2ca8a1: 2ca8 A:85-211

Lineage for d2ca8a1 (2ca8 A:85-211)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Blood fluke (Schistosoma haematobium) [TaxId:6185] [89060] (4 PDB entries)

8. Domain d2ca8a1: 2ca8 A:85-211 [130153]
   Other proteins in same PDB: d2ca8a2
   automated match to d1oe8a1
   complexed with gsh, pg4

Details for d2ca8a1

PDB Entry: 2ca8, 2.49 Å

PDB Description: Structure of Sh28GST in complex with GSH at pH 6.0

PDB Compounds: (A:) glutathione s-transferase 28 kda

SCOPe Domain Sequences for d2ca8a1:

Sequence; same for both SEQRES and ATOM records:

>d2ca8a1 a.45.1.1 (A:85-211) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]}
mggteeeyynvekligqaedleheyyktlmkpeeekqkiikeilngkvpvlldiiceslk
astgklavgdkvtladlvliavidhvtdldkefltgkypeihkhrenllassprlakyls
draatpf

Timeline for d2ca8a1:

• d2ca8a1 first appeared in SCOP 1.73
  
• d2ca8a1 appears in SCOPe 2.05
  
• d2ca8a1 appears in SCOPe 2.07
  
• d2ca8a1 appears in the current release, SCOPe 2.08