Lineage for d2ca6b1 (2ca6 B:2-345)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 690278Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 690279Superfamily c.10.1: RNI-like [52047] (3 families) (S)
    regular structure consisting of similar repeats
  5. 690299Family c.10.1.2: Rna1p (RanGAP1), N-terminal domain [52052] (1 protein)
    this is a repeat family; one repeat unit is 1k5d C:168-196 found in domain
  6. 690300Protein Rna1p (RanGAP1), N-terminal domain [52053] (1 species)
    GTPase-activating protein for SpI1, ortologue of Ran
    duplication: consists of 11 repeats
  7. 690301Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [52054] (4 PDB entries)
  8. 690303Domain d2ca6b1: 2ca6 B:2-345 [130152]
    automatically matched to d1k5dc_
    complexed with so4

Details for d2ca6b1

PDB Entry: 2ca6 (more details), 2.2 Å

PDB Description: miras structure determination from hemihedrally twinned crystals
PDB Compounds: (B:) ran gtpase-activating protein 1

SCOP Domain Sequences for d2ca6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ca6b1 c.10.1.2 (B:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
arfsiegkslkldaittedeksvfavlleddsvkeivlsgntigteaarwlseniaskkd
leiaefsdiftgrvkdeipealrlllqallkcpklhtvrlsdnafgptaqeplidflskh
tplehlylhnnglgpqagakiaralqelavnkkaknapplrsiicgrnrlengsmkewak
tfqshrllhtvkmvqngirpegiehllleglaycqelkvldlqdntfthlgssalaialk
swpnlrelglndcllsargaaavvdafskleniglqtlrlqyneieldavrtlktvidek
mpdllflelngnrfseeddvvdeirevfstrgrgeldelddmee

SCOP Domain Coordinates for d2ca6b1:

Click to download the PDB-style file with coordinates for d2ca6b1.
(The format of our PDB-style files is described here.)

Timeline for d2ca6b1: