Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (8 families) |
Family d.15.1.1: Ubiquitin-related [54237] (38 proteins) Pfam PF00240 |
Protein Elongin B [54246] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [54247] (7 PDB entries) |
Domain d2c9wb1: 2c9w B:2-104 [130145] Other proteins in same PDB: d2c9wa1, d2c9wa2, d2c9wc1 automatically matched to d1lm8b_ complexed with ni, so4 |
PDB Entry: 2c9w (more details), 1.9 Å
SCOP Domain Sequences for d2c9wb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} dvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgecg ftsqtarpqapatvglafraddtfealciepfssppelpdvmk
Timeline for d2c9wb1: