Lineage for d2c9wb1 (2c9w B:2-104)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 853596Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 853597Superfamily d.15.1: Ubiquitin-like [54236] (8 families) (S)
  5. 853598Family d.15.1.1: Ubiquitin-related [54237] (38 proteins)
    Pfam PF00240
  6. 853624Protein Elongin B [54246] (2 species)
  7. 853625Species Human (Homo sapiens) [TaxId:9606] [54247] (7 PDB entries)
  8. 853626Domain d2c9wb1: 2c9w B:2-104 [130145]
    Other proteins in same PDB: d2c9wa1, d2c9wa2, d2c9wc1
    automatically matched to d1lm8b_
    complexed with ni, so4

Details for d2c9wb1

PDB Entry: 2c9w (more details), 1.9 Å

PDB Description: crystal structure of socs-2 in complex with elongin-b and elongin-c at 1.9a resolution
PDB Compounds: (B:) Transcription elongation factor B polypeptide 2

SCOP Domain Sequences for d2c9wb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
dvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgecg
ftsqtarpqapatvglafraddtfealciepfssppelpdvmk

SCOP Domain Coordinates for d2c9wb1:

Click to download the PDB-style file with coordinates for d2c9wb1.
(The format of our PDB-style files is described here.)

Timeline for d2c9wb1: