Lineage for d2c9pc_ (2c9p C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765951Family b.1.18.17: Copper resistance protein C (CopC, PcoC) [81969] (1 protein)
    automatically mapped to Pfam PF04234
    automatically mapped to Pfam PF13205
  6. 2765952Protein Copper resistance protein C (CopC, PcoC) [81970] (3 species)
  7. 2765963Species Pseudomonas syringae [TaxId:323] [187019] (2 PDB entries)
  8. 2765967Domain d2c9pc_: 2c9p C: [130137]
    automated match to d1m42a_
    complexed with cu, no3

Details for d2c9pc_

PDB Entry: 2c9p (more details), 2.25 Å

PDB Description: cu(i)cu(ii)-copc at ph 4.5
PDB Compounds: (C:) copper resistance protein c

SCOPe Domain Sequences for d2c9pc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c9pc_ b.1.18.17 (C:) Copper resistance protein C (CopC, PcoC) {Pseudomonas syringae [TaxId: 323]}
hpklvsstpaegsegaapakielhfsenlvtqfsgaklvmtampgmehspmavkaavsgg
gdpktmvitpaspltagtykvdwravssdthpitgsvtfkvk

SCOPe Domain Coordinates for d2c9pc_:

Click to download the PDB-style file with coordinates for d2c9pc_.
(The format of our PDB-style files is described here.)

Timeline for d2c9pc_: