Lineage for d2c9pa1 (2c9p A:1-102)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788950Superfamily b.1.18: E set domains [81296] (23 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 789632Family b.1.18.17: Copper resistance protein C (CopC, PcoC) [81969] (1 protein)
  6. 789633Protein Copper resistance protein C (CopC, PcoC) [81970] (2 species)
  7. 789639Species Pseudomonas syringae [TaxId:317] [81971] (5 PDB entries)
  8. 789641Domain d2c9pa1: 2c9p A:1-102 [130135]
    automatically matched to d1m42a_
    complexed with cu, no3

Details for d2c9pa1

PDB Entry: 2c9p (more details), 2.25 Å

PDB Description: cu(i)cu(ii)-copc at ph 4.5
PDB Compounds: (A:) copper resistance protein c

SCOP Domain Sequences for d2c9pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c9pa1 b.1.18.17 (A:1-102) Copper resistance protein C (CopC, PcoC) {Pseudomonas syringae [TaxId: 317]}
hpklvsstpaegsegaapakielhfsenlvtqfsgaklvmtampgmehspmavkaavsgg
gdpktmvitpaspltagtykvdwravssdthpitgsvtfkvk

SCOP Domain Coordinates for d2c9pa1:

Click to download the PDB-style file with coordinates for d2c9pa1.
(The format of our PDB-style files is described here.)

Timeline for d2c9pa1: