![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins) interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain |
![]() | Protein Alpha-l-arabinofuranosidase [101924] (2 species) glycosyl hydrolase family 51 |
![]() | Species Clostridium thermocellum [TaxId:1515] [141554] (2 PDB entries) |
![]() | Domain d2c8na1: 2c8n A:2-16,A:387-502 [130109] Other proteins in same PDB: d2c8na2, d2c8nb2, d2c8nc2, d2c8nd2, d2c8ne2, d2c8nf2 automatically matched to 2C7F A:2-16,A:387-502 complexed with ahr, edo, xys; mutant |
PDB Entry: 2c8n (more details), 2.9 Å
SCOP Domain Sequences for d2c8na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c8na1 b.71.1.2 (A:2-16,A:387-502) Alpha-l-arabinofuranosidase {Clostridium thermocellum [TaxId: 1515]} kkarmtvdkdykiaeXgivlqpvinsplhdtskhedvtdiesvaiyneekeevtifavnr nihedivlvsdvrgmkdyrllehivlehqdlkirnsvngeevypknsdkssfddgiltsm lrraswnvirig
Timeline for d2c8na1: