SCOPe 2.05: Domain d2c89c_: 2c89 C:

Lineage for d2c89c_ (2c89 C:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)

6. Protein automated matches [190133] (5 species)
   not a true protein

7. Species Clostridium botulinum [TaxId:1491] [187018] (9 PDB entries)

8. Domain d2c89c_: 2c89 C: [130097]
   automated match to d1g24a_
   complexed with so4

Details for d2c89c_

PDB Entry: 2c89, 1.85 Å

PDB Description: structure of the wild-type c3bot1 exoenzyme (free state, crystal form i)

PDB Compounds: (C:) Mono-ADP-ribosyltransferase C3

SCOPe Domain Sequences for d2c89c_:

Sequence; same for both SEQRES and ATOM records:

>d2c89c_ d.166.1.1 (C:) automated matches {Clostridium botulinum [TaxId: 1491]}
tyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingfpsnl
ikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekakakfln
kdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagqlemllprhstyh
iddmrlssdgkqiiitatmmgtainpk

Timeline for d2c89c_:

• d2c89c_ first appeared in SCOP 1.73, called d2c89c1
  
• d2c89c_ appears in SCOPe 2.04
  
• d2c89c_ appears in SCOPe 2.06
  
• d2c89c_ appears in the current release, SCOPe 2.08