![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species) |
![]() | Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (92 PDB entries) Uniprot P01892 25-298 |
![]() | Domain d2c7ud2: 2c7u D:1-181 [130087] Other proteins in same PDB: d2c7ua1, d2c7ub_, d2c7ud1, d2c7ue_ automatically matched to d1akja2 |
PDB Entry: 2c7u (more details), 2.38 Å
SCOPe Domain Sequences for d2c7ud2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c7ud2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]} gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq r
Timeline for d2c7ud2:
![]() Domains from other chains: (mouse over for more information) d2c7ua1, d2c7ua2, d2c7ub_, d2c7ue_ |