Lineage for d2c7ua2 (2c7u A:1-181)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1197982Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1197983Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1197984Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1198031Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 1198044Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (76 PDB entries)
    Uniprot P01892 25-298
  8. 1198130Domain d2c7ua2: 2c7u A:1-181 [130084]
    Other proteins in same PDB: d2c7ua1, d2c7ub_, d2c7ud1, d2c7ue_
    automatically matched to d1akja2

Details for d2c7ua2

PDB Entry: 2c7u (more details), 2.38 Å

PDB Description: conflicting selective forces affect cd8 t-cell receptor contact sites in an hla-a2 immunodominant hiv epitope.
PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d2c7ua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c7ua2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d2c7ua2:

Click to download the PDB-style file with coordinates for d2c7ua2.
(The format of our PDB-style files is described here.)

Timeline for d2c7ua2: