Class b: All beta proteins [48724] (174 folds) |
Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
Superfamily b.35.1: GroES-like [50129] (3 families) |
Family b.35.1.1: GroES [50130] (2 proteins) |
Protein Chaperonin-10 (GroES) [50131] (4 species) |
Species Escherichia coli [TaxId:562] [50132] (7 PDB entries) |
Domain d2c7cu1: 2c7c U:3-95 [130047] automatically matched to d1aono_ |
PDB Entry: 2c7c (more details), 7.7 Å
SCOPe Domain Sequences for d2c7cu1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c7cu1 b.35.1.1 (U:3-95) Chaperonin-10 (GroES) {Escherichia coli [TaxId: 562]} irplhdrvivkrkevetksaggivltgsaaakstrgevlavgngrilengevkpldvkvg divifndgygvksekidneevlimsesdilaiv
Timeline for d2c7cu1: