SCOPe 2.02: Domain d2c5xd2: 2c5x D:309-432

Lineage for d2c5xd2 (2c5x D:309-432)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (3 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (8 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (52 PDB entries)
   Uniprot P20248 175-432

8. Domain d2c5xd2: 2c5x D:309-432 [129964]
   Other proteins in same PDB: d2c5xa_, d2c5xc_
   automatically matched to d1vin_2
   complexed with mtw

Details for d2c5xd2

PDB Entry: 2c5x, 2.9 Å

PDB Description: differential binding of inhibitors to active and inactive cdk2 provides insights for drug design

PDB Compounds: (D:) cyclin a2

SCOPe Domain Sequences for d2c5xd2:

Sequence; same for both SEQRES and ATOM records:

>d2c5xd2 a.74.1.1 (D:309-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
ptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvt
gqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppe
tlnl

Timeline for d2c5xd2:

• d2c5xd2 first appeared in SCOP 1.73
  
• d2c5xd2 appears in SCOPe 2.01
  
• d2c5xd2 appears in SCOPe 2.03
  
• d2c5xd2 appears in the current release, SCOPe 2.08