SCOP 1.73: Domain d2c5vd1: 2c5v D:181-308

Lineage for d2c5vd1 (2c5v D:181-308)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (3 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (4 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47958] (19 PDB entries)

8. Domain d2c5vd1: 2c5v D:181-308 [129956]
   Other proteins in same PDB: d2c5va1, d2c5vc1
   automatically matched to d1vin_1
   complexed with ab7, ck4, nh2, pff

Details for d2c5vd1

PDB Entry: 2c5v, 2.9 Å

PDB Description: differential binding of inhibitors to active and inactive cdk2 provides insights for drug design

PDB Compounds: (D:) cyclin a2

SCOP Domain Sequences for d2c5vd1:

Sequence; same for both SEQRES and ATOM records:

>d2c5vd1 a.74.1.1 (D:181-308) Cyclin A {Cow (Bos taurus) [TaxId: 9913]}
dihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavnyid
rflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehlvlk
vltfdlaa

Timeline for d2c5vd1:

• d2c5vd1 is new in SCOP 1.73
  
• d2c5vd1 appears in SCOP 1.75
  
• d2c5vd1 appears in the current release, SCOPe 2.08