Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) |
Family d.15.1.5: Ras-binding domain, RBD [54263] (14 proteins) contains Pfam PF00788 and Pfam PF02196 |
Protein Phospholipase C-epsilon-1 [142966] (1 species) contains several Ras-binding domains; some are 'hidden' in the sequence |
Species Human (Homo sapiens) [TaxId:9606] [142967] (3 PDB entries) Uniprot Q9P212 2006-2114! Uniprot Q9P212 2131-2246! Uniprot Q9P212 2134-2239 |
Domain d2c5lc1: 2c5l C:2134-2239 [129924] Other proteins in same PDB: d2c5la_, d2c5lb_, d2c5ld_ complexed with gol, gtp, mg |
PDB Entry: 2c5l (more details), 1.9 Å
SCOPe Domain Sequences for d2c5lc1:
Sequence, based on SEQRES records: (download)
>d2c5lc1 d.15.1.5 (C:2134-2239) Phospholipase C-epsilon-1 {Human (Homo sapiens) [TaxId: 9606]} eesffvqvhdvspeqprtvikaprvstaqdviqqtlckakyslsilsnpnpsdyvlleev vkdttnkktttpkssqrvlldqecvfqaqskwkgagkfilklkeqv
>d2c5lc1 d.15.1.5 (C:2134-2239) Phospholipase C-epsilon-1 {Human (Homo sapiens) [TaxId: 9606]} eesffvqvhdvspeqprtvikaprvstaqdviqqtlckakyslsilsnpnpsdyvlleev vkdkssqrvlldqecvfqaqskwkgagkfilklkeqv
Timeline for d2c5lc1: