Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (78 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein cH-p21 Ras protein [52593] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [52594] (52 PDB entries) |
Domain d2c5lb1: 2c5l B:1-166 [129923] Other proteins in same PDB: d2c5lc1, d2c5ld1 automatically matched to d2q21__ complexed with gol, gtp, mg; mutant |
PDB Entry: 2c5l (more details), 1.9 Å
SCOP Domain Sequences for d2c5lb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c5lb1 c.37.1.8 (B:1-166) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
Timeline for d2c5lb1: