SCOP 1.73: Domain d2c4oc1: 2c4o C:1-147

Lineage for d2c4oc1 (2c4o C:1-147)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (4 families)

5. Family d.20.1.1: UBC-related [54496] (6 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (31 species)

7. Species Human (Homo sapiens), ubch5b [TaxId:9606] [102841] (8 PDB entries)
   E2-17 kDa 2

8. Domain d2c4oc1: 2c4o C:1-147 [129840]
   automatically matched to d1ur6a_
   complexed with gol, so4

Details for d2c4oc1

PDB Entry: 2c4o, 1.94 Å

PDB Description: Crystal structure of human ubiquitin-conjugating enzyme UbcH5B

PDB Compounds: (C:) ubiquitin-conjugating enzyme e2 d2

SCOP Domain Sequences for d2c4oc1:

Sequence; same for both SEQRES and ATOM records:

>d2c4oc1 d.20.1.1 (C:1-147) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch5b [TaxId: 9606]}
malkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdy
pfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplv
peiariyktdrekynriarewtqkyam

Timeline for d2c4oc1:

• d2c4oc1 is new in SCOP 1.73
  
• d2c4oc1 appears in SCOP 1.75
  
• d2c4oc1 last appears in SCOPe 2.04, called d2c4oc_