Lineage for d2c4fl2 (2c4f L:91-140)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2258094Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2258095Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2258104Protein Coagulation factor VIIa [57201] (1 species)
  7. 2258105Species Human (Homo sapiens) [TaxId:9606] [57202] (96 PDB entries)
    Uniprot P08709 108-202 ! Uniprot P08709 107-202
  8. 2258121Domain d2c4fl2: 2c4f L:91-140 [129807]
    Other proteins in same PDB: d2c4fh1, d2c4fl3, d2c4fu1
    automatically matched to d1pfxl2
    complexed with ca, fuc, gil, glc, nag

Details for d2c4fl2

PDB Entry: 2c4f (more details), 1.72 Å

PDB Description: crystal structure of factor vii.stf complexed with pd0297121
PDB Compounds: (L:) coagulation factor vii precursor

SCOPe Domain Sequences for d2c4fl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c4fl2 g.3.11.1 (L:91-140) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
cvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipi

SCOPe Domain Coordinates for d2c4fl2:

Click to download the PDB-style file with coordinates for d2c4fl2.
(The format of our PDB-style files is described here.)

Timeline for d2c4fl2: