SCOP 1.73: Domain d2c4fl1: 2c4f L:46-82

Lineage for d2c4fl1 (2c4f L:46-82)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (7 families)

5. Family g.3.11.1: EGF-type module [57197] (22 proteins)

6. Protein Factor IX (IXa) [57198] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [57200] (16 PDB entries)

8. Domain d2c4fl1: 2c4f L:46-82 [129806]
   Other proteins in same PDB: d2c4fh1, d2c4fl3
   automatically matched to d1pfxl1
   complexed with ca, fuc, gil, glc, nag

Details for d2c4fl1

PDB Entry: 2c4f, 1.72 Å

PDB Description: crystal structure of factor vii.stf complexed with pd0297121

PDB Compounds: (L:) coagulation factor vii precursor

SCOP Domain Sequences for d2c4fl1:

Sequence; same for both SEQRES and ATOM records:

>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]}
dgdqcasspcqnggsckdqlqsyicfclpafegrnce

Timeline for d2c4fl1:

• d2c4fl1 is new in SCOP 1.73
  
• d2c4fl1 appears in SCOP 1.75
  
• d2c4fl1 appears in the current release, SCOPe 2.08