Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) |
Family c.48.1.3: Pyruvate-ferredoxin oxidoreductase, PFOR, domain II [52931] (1 protein) |
Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain II [52932] (1 species) |
Species Desulfovibrio africanus [TaxId:873] [52933] (9 PDB entries) |
Domain d2c3ub3: 2c3u B:259-415 [129777] Other proteins in same PDB: d2c3ua1, d2c3ua2, d2c3ua4, d2c3ua5, d2c3ub1, d2c3ub2, d2c3ub4, d2c3ub5 automatically matched to d1b0pa3 complexed with 2tp, ca, mg, pyr, sf4 |
PDB Entry: 2c3u (more details), 2.32 Å
SCOP Domain Sequences for d2c3ub3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c3ub3 c.48.1.3 (B:259-415) Pyruvate-ferredoxin oxidoreductase, PFOR, domain II {Desulfovibrio africanus [TaxId: 873]} klfdyvgapdaervivsmgsscetieevinhlaakgekiglikvrlyrpfvseaffaalp asakvitvldrtkepgapgdplyldvcsafvergeampkilagryglgskefspamvksv ydnmsgakknhftvgieddvtgtslpvdnafadttpk
Timeline for d2c3ub3: