SCOP 1.73: Domain d2c3la1: 2c3l A:2-273

Lineage for d2c3la1 (2c3l A:2-273)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Cell cycle checkpoint kinase chk1 [64404] (1 species)
   CaMK group; CAMKL subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [64405] (27 PDB entries)

8. Domain d2c3la1: 2c3l A:2-273 [129739]
   automatically matched to d1ia8a_
   complexed with idz, so4

Details for d2c3la1

PDB Entry: 2c3l, 2.35 Å

PDB Description: identification of a buried pocket for potent and selective inhibition of chk1: prediction and verification

PDB Compounds: (A:) Serine/threonine-protein kinase Chk1

SCOP Domain Sequences for d2c3la1:

Sequence, based on SEQRES records:

>d2c3la1 d.144.1.7 (A:2-273) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]}
avpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicinkm
lnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvyl
hgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkr
refhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplal
lhkilvenpsaritipdikkdrwynkplkkga

Sequence, based on observed residues (ATOM records):

>d2c3la1 d.144.1.7 (A:2-273) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]}
avpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkrikkeicinkmlnhenvv
kfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvylhgigith
rdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrrefhaep
vdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhkilve
npsaritipdikkdrwynkplkkga

Timeline for d2c3la1:

• d2c3la1 is new in SCOP 1.73
  
• d2c3la1 appears in SCOP 1.75
  
• d2c3la1 appears in the current release, SCOPe 2.08, called d2c3la_