Lineage for d2c2vu_ (2c2v U:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1245811Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 1245812Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 1245922Family g.44.1.0: automated matches [191345] (1 protein)
    not a true family
  6. 1245923Protein automated matches [190242] (2 species)
    not a true protein
  7. 1245928Species Mouse (Mus musculus) [TaxId:10090] [187013] (1 PDB entry)
  8. 1245930Domain d2c2vu_: 2c2v U: [129696]
    Other proteins in same PDB: d2c2vb_, d2c2vc1, d2c2ve_, d2c2vf_, d2c2vh_, d2c2vi_, d2c2vk_, d2c2vl_, d2c2vs1
    automated match to d1t1ha_

Details for d2c2vu_

PDB Entry: 2c2v (more details), 2.9 Å

PDB Description: crystal structure of the chip-ubc13-uev1a complex
PDB Compounds: (U:) carboxy terminus of hsp70-interacting protein

SCOPe Domain Sequences for d2c2vu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c2vu_ g.44.1.0 (U:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dipdylcgkisfelmrepcitpsgitydrkdieehlqrvghfnpvtrspltqeqlipnla
mkevidafiseng

SCOPe Domain Coordinates for d2c2vu_:

Click to download the PDB-style file with coordinates for d2c2vu_.
(The format of our PDB-style files is described here.)

Timeline for d2c2vu_: