Lineage for d2c2vh1 (2c2v H:6-154)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720005Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 720006Superfamily d.20.1: UBC-like [54495] (4 families) (S)
  5. 720007Family d.20.1.1: UBC-related [54496] (6 proteins)
  6. 720015Protein Ubiquitin conjugating enzyme, UBC [54497] (31 species)
  7. 720076Species Human (Homo sapiens), ubc13 [TaxId:9606] [64240] (2 PDB entries)
  8. 720080Domain d2c2vh1: 2c2v H:6-154 [129690]
    Other proteins in same PDB: d2c2vs1, d2c2vt1, d2c2vu1, d2c2vv1
    automatically matched to d1j7db_

Details for d2c2vh1

PDB Entry: 2c2v (more details), 2.9 Å

PDB Description: crystal structure of the chip-ubc13-uev1a complex
PDB Compounds: (H:) Ubiquitin-conjugating enzyme E2 N

SCOP Domain Sequences for d2c2vh1:

Sequence, based on SEQRES records: (download)

>d2c2vh1 d.20.1.1 (H:6-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]}
aglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpee
ypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpl
andvaeqwktneaqaietarawtrlyamn

Sequence, based on observed residues (ATOM records): (download)

>d2c2vh1 d.20.1.1 (H:6-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]}
aglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpee
ypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpn
dvaeqwktneaqaietarawtrlyamn

SCOP Domain Coordinates for d2c2vh1:

Click to download the PDB-style file with coordinates for d2c2vh1.
(The format of our PDB-style files is described here.)

Timeline for d2c2vh1: