SCOPe 2.08: Domain d2c2ra2: 2c2r A:1-240

Lineage for d2c2ra2 (2c2r A:1-240)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (5 proteins)
   contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein automated matches [231300] (5 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:273057] [231301] (28 PDB entries)

8. Domain d2c2ra2: 2c2r A:1-240 [129681]
   Other proteins in same PDB: d2c2ra1
   automated match to d2v4ra1
   complexed with ca, dct

Details for d2c2ra2

PDB Entry: 2c2r, 2.55 Å

PDB Description: efficient and high fidelity incorporation of dctp opposite 7,8-dihydro-8-oxodeoxyguanosine by sulfolobus solfataricus dna polymerase dpo4

PDB Compounds: (A:) DNA polymerase IV

SCOPe Domain Sequences for d2c2ra2:

Sequence; same for both SEQRES and ATOM records:

>d2c2ra2 e.8.1.7 (A:1-240) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
mivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagip
iveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyre
aynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldi
advpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr

Timeline for d2c2ra2:

• d2c2ra2 first appeared in SCOP 1.73
  
• d2c2ra2 appears in SCOPe 2.07