Lineage for d2c2hb1 (2c2h B:3-177)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 695634Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 696233Protein Rac3 [142255] (1 species)
  7. 696234Species Human (Homo sapiens) [TaxId:9606] [142256] (1 PDB entry)
  8. 696236Domain d2c2hb1: 2c2h B:3-177 [129669]
    automatically matched to 2C2H A:3-177
    complexed with ca, gdp, mg, so4; mutant

Details for d2c2hb1

PDB Entry: 2c2h (more details), 1.85 Å

PDB Description: crystal structure of the human rac3 in complex with gdp
PDB Compounds: (B:) ras-related c3 botulinum toxin substrate 3

SCOP Domain Sequences for d2c2hb1:

Sequence, based on SEQRES records: (download)

>d2c2hb1 c.37.1.8 (B:3-177) Rac3 {Human (Homo sapiens) [TaxId: 9606]}
aikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtagqe
dydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcphtpillvgtkldlrdd
kdtierlrdkklapitypqglamareigsvkylecsaltqrglktvfdeairavl

Sequence, based on observed residues (ATOM records): (download)

>d2c2hb1 c.37.1.8 (B:3-177) Rac3 {Human (Homo sapiens) [TaxId: 9606]}
aikcvvvgdgavgktcllisyttnafpgeyidnysanvmvdgkpvnlglwdtagqedydr
lrplsypqtdvflicfslvspasfenvrakwypevrhhcphtpillvgtkldlrddkdti
erlrdkklapitypqglamareigsvkylecsaltqrglktvfdeairavl

SCOP Domain Coordinates for d2c2hb1:

Click to download the PDB-style file with coordinates for d2c2hb1.
(The format of our PDB-style files is described here.)

Timeline for d2c2hb1: