Lineage for d2c1ta1 (2c1t A:89-510)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 775277Superfamily a.118.1: ARM repeat [48371] (23 families) (S)
  5. 775278Family a.118.1.1: Armadillo repeat [48372] (6 proteins)
  6. 775348Protein Karyopherin alpha [48383] (1 species)
  7. 775349Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48384] (7 PDB entries)
    Uniprot Q02821 12-514
  8. 775358Domain d2c1ta1: 2c1t A:89-510 [129642]
    automatically matched to d1bk6a_
    mutant

Details for d2c1ta1

PDB Entry: 2c1t (more details), 2.6 Å

PDB Description: structure of the kap60p:nup2 complex
PDB Compounds: (A:) importin alpha subunit

SCOP Domain Sequences for d2c1ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c1ta1 a.118.1.1 (A:89-510) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lpqmtqqlnsddmqeqlsatvkfrqilsrehrppidvviqagvvprlvefmrenqpemlq
leaawaltniasgtsaqtkvvvdadavplfiqllytgsvevkeqaiwalgnvagdstdyr
dyvlqcnamepilglfnsnkpslirtatwtlsnlcrgkkpqpdwsvvsqalptlakliys
mdtetlvdacwaisylsdgpqeaiqavidvripkrlvellshestlvqtpalravgnivt
gndlqtqvvinagvlpalrlllsspkenikkeacwtisnitagnteqiqavidanlippl
vkllevaedktkkeacwaisnassgglqrpdiirylvsqgcikplcdlleiadnriievt
ldalenilkmgeadkearglninenadfiekaggmekifncqqnendkiyekaykiiety
fg

SCOP Domain Coordinates for d2c1ta1:

Click to download the PDB-style file with coordinates for d2c1ta1.
(The format of our PDB-style files is described here.)

Timeline for d2c1ta1: