SCOPe 2.05: Domain d2c0ud2: 2c0u D:2-260

Lineage for d2c0ud2 (2c0u D:2-260)

1. Root: SCOPe 2.05

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
   2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology

4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families)
   flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)

5. Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (10 proteins)

6. Protein Nitroalkane oxidase [144026] (1 species)

7. Species Fungus (Fusarium oxysporum) [TaxId:5507] [144027] (2 PDB entries)
   Uniprot Q8X1D8 2-260

8. Domain d2c0ud2: 2c0u D:2-260 [129614]
   Other proteins in same PDB: d2c0ua1, d2c0ub1, d2c0uc1, d2c0ud1
   automated match to d2c0ua2
   complexed with fad, nbt

Details for d2c0ud2

PDB Entry: 2c0u, 2.2 Å

PDB Description: crystal structure of a covalent complex of nitroalkane oxidase trapped during substrate turnover

PDB Compounds: (D:) nitroalkane oxidase

SCOPe Domain Sequences for d2c0ud2:

Sequence; same for both SEQRES and ATOM records:

>d2c0ud2 e.6.1.1 (D:2-260) Nitroalkane oxidase {Fungus (Fusarium oxysporum) [TaxId: 5507]}
vdfklspsqlearrhaqafantvltkasaeystqkdqlsrfqatrpfyreavrhglikaq
vpiplggtmeslvhesiileelfavepatsitivatalglmpvilcdspslqekflkpfi
sgegeplaslmhsepngtanwlqkggpglqttarkvgnewvisgeklwpsnsggwdykga
dlacvvcrvsddpskpqdpnvdpatqiavllvtretiannkkdayqilgepelaghitts
gphtrftefhvphenllct

Timeline for d2c0ud2:

• d2c0ud2 first appeared in SCOP 1.73
  
• d2c0ud2 appears in SCOPe 2.04
  
• d2c0ud2 appears in SCOPe 2.06
  
• d2c0ud2 appears in the current release, SCOPe 2.08