Lineage for d2c0mf1 (2c0m F:285-602)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 775786Superfamily a.118.8: TPR-like [48452] (8 families) (S)
  5. 775787Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (17 proteins)
  6. 775837Protein Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) [48462] (2 species)
  7. 775838Species Human (Homo sapiens) [TaxId:9606] [48463] (3 PDB entries)
  8. 775845Domain d2c0mf1: 2c0m F:285-602 [129599]
    automatically matched to d1fcha_

Details for d2c0mf1

PDB Entry: 2c0m (more details), 2.5 Å

PDB Description: apo form of the tpr domain of the pex5p receptor
PDB Compounds: (F:) peroxisomal targeting signal 1 receptor

SCOP Domain Sequences for d2c0mf1:

Sequence, based on SEQRES records: (download)

>d2c0mf1 a.118.8.1 (F:285-602) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]}
kgyqfeeenplrdhpqpfeeglrrlqegdlpnavllfeaavqqdpkhmeawqylgttqae
neqellaisalrrclelkpdnqtalmalavsftneslqrqaceilrdwlrytpayahlvt
paeegaggaglgpskrilgsllsdslflevkelflaavrldptsidpdvqcglgvlfnls
geydkavdcftaalsvrpndyllwnklgatlangnqseeavaayrralelqpgyirsryn
lgiscinlgahreavehflealnmqrksrgprgeggamseniwstlrlalsmlgqsdayg
aadardlstlltmfglpq

Sequence, based on observed residues (ATOM records): (download)

>d2c0mf1 a.118.8.1 (F:285-602) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]}
kgyqfeeenplrdhpqpfeeglrrlqegdlpnavllfeaavqqdpkhmeawqylgttqae
neqellaisalrrclelkpdnqtalmalavsftneslqrqaceilrdwlrytpayahlvr
ilgsllsdslflevkelflaavrldptsidpdvqcglgvlfnlsgeydkavdcftaalsv
rpndyllwnklgatlangnqseeavaayrralelqpgyirsrynlgiscinlgahreave
hflealnmqrksrgprgeggamseniwstlrlalsmlgqsdaygaadardlstlltmfgl
pq

SCOP Domain Coordinates for d2c0mf1:

Click to download the PDB-style file with coordinates for d2c0mf1.
(The format of our PDB-style files is described here.)

Timeline for d2c0mf1: