Lineage for d2bz9a1 (2bz9 A:2-449)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 774742Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 774743Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 774744Family a.104.1.1: Cytochrome P450 [48265] (22 proteins)
  6. 774791Protein Cytochrome p450 14 alpha-sterol demethylase (cyp51) [48276] (1 species)
  7. 774792Species Mycobacterium tuberculosis [TaxId:1773] [48277] (9 PDB entries)
    Uniprot P0A512 P77901
  8. 774801Domain d2bz9a1: 2bz9 A:2-449 [129554]
    automatically matched to d1x8va_
    complexed with hem; mutant

Details for d2bz9a1

PDB Entry: 2bz9 (more details), 2.21 Å

PDB Description: ligand-free structure of sterol 14alpha-demethylase from mycobacterium tuberculosis in p2(1) space group
PDB Compounds: (A:) sterol 14alpha-demethylase

SCOP Domain Sequences for d2bz9a1:

Sequence, based on SEQRES records: (download)

>d2bz9a1 a.104.1.1 (A:2-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]}
savalprvsgghdehghleefrtdpiglmqrvrdelgdvgtfqlagkqvvllsgshanef
ffragdddldqakaypfmtpifgegvvfdasperrkemlhnaalrgeqmkghaatiedqv
rrmiadwgeageidlldffaeltiytssacligkkfrdqldgrfaklyhelergtdplay
vdpylpiesfrrrdearnglvalvadimngrianpptdksdrdmldvliavkaetgtprf
sadeitgmfismmfaghhtssgtaswtlielmrhrdayaavideldelygdgrsvsfhal
rqipqlenvlketlrlhppliilmrvakgefevqghrihegdlvaaspaisnripedfpd
phdfvparyeqprqedllnrwtwipfgagrhrcvgaafaimqikaifsvllreyefemaq
ppesyrndhskmvvqlaqpaavryrrrt

Sequence, based on observed residues (ATOM records): (download)

>d2bz9a1 a.104.1.1 (A:2-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]}
savalprvsgghdehghleefrtdpiglmqrvrdelgdvgtfqlagkqvvllsgshanef
ffragdddldqakaypfmtpifgmlhnaalrgeqmkghaatiedqvrrmiadwgeageid
lldffaeltiytssacligkkfrdqldgrfaklyhelergtdplayvdpylpiesfrrrd
earnglvalvadimngrianpsdrdmldvliavkaetgtprfsadeitgmfismmfaghh
tssgtaswtlielmrhrdayaavideldelygdgrsvsfhalrqipqlenvlketlrlhp
pliilmrvakgefevqghrihegdlvaaspaisnripedfpdphdfvparyeqprqedll
nrwtwipfgagrhrcvgaafaimqikaifsvllreyefemaqppesyrndhskmvvqlaq
paavryrrrt

SCOP Domain Coordinates for d2bz9a1:

Click to download the PDB-style file with coordinates for d2bz9a1.
(The format of our PDB-style files is described here.)

Timeline for d2bz9a1: