SCOPe 2.07: Domain d2bz6l_: 2bz6 L:

Lineage for d2bz6l_ (2bz6 L:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein automated matches [190092] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187310] (72 PDB entries)

8. Domain d2bz6l_: 2bz6 L: [129553]
   Other proteins in same PDB: d2bz6h_
   automated match to d1klil_
   complexed with 346, ca, so4

Details for d2bz6l_

PDB Entry: 2bz6, 1.6 Å

PDB Description: orally available factor7a inhibitor

PDB Compounds: (L:) blood coagulation factor viia

SCOPe Domain Sequences for d2bz6l_:

Sequence; same for both SEQRES and ATOM records:

>d2bz6l_ g.3.11.1 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
icvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile

Timeline for d2bz6l_:

• d2bz6l_ first appeared in SCOP 1.73, called d2bz6l1
  
• d2bz6l_ appears in SCOPe 2.06
  
• d2bz6l_ appears in the current release, SCOPe 2.08