Class g: Small proteins [56992] (90 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (7 families) |
Family g.3.11.1: EGF-type module [57197] (22 proteins) |
Protein Coagulation factor VIIa [57201] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57202] (19 PDB entries) Uniprot P08709 108-202 Uniprot P08709 107-202 Uniprot P08709 108-202 ! Uniprot P08709 107-202 |
Domain d2bz6l1: 2bz6 L:90-142 [129553] Other proteins in same PDB: d2bz6h1 automatically matched to d1klil_ complexed with 346, ca, so4 |
PDB Entry: 2bz6 (more details), 1.6 Å
SCOP Domain Sequences for d2bz6l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} icvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile
Timeline for d2bz6l1: